PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA8428
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Nin-like
Protein Properties Length: 1020aa    MW: 115720 Da    PI: 5.3039
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA8428genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.52.7e-28753803252
                    RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                               ek isl++l++yFs+++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rkik++
  Tp57577_TGAC_v2_mRNA8428 753 EKLISLDVLQNYFSGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKIKKV 803
                               6889*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.063740823IPR003035RWP-RK domain
PfamPF020421.8E-25756803IPR003035RWP-RK domain
SuperFamilySSF542772.68E-239251010No hitNo description
PROSITE profilePS5174523.69251007IPR000270PB1 domain
SMARTSM006665.7E-259251007IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2403.3E-259261006No hitNo description
CDDcd064078.19E-369261006No hitNo description
PfamPF005645.1E-199261006IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1020 aa     Download sequence    Send to blast
MQESEEENHD LPQKSKPLDE TGFSMNFDID FENSWPLDHI SNTMYPFLLS TTSQQQHFSP  60
IWTFSDVEDD SIEASGFLSF ILLFLCFWFI SLLLSGNNTK IVTENRVEND DKKKHVTAQH  120
VDALPPLQNP HGYCLIKERM TQALRQFKEW TEQNVLAQVW APVRNGNRYK LTTSGQPFVL  180
DPHSNGLHQY RTVSLMYMFS VDGENDEILG LPGRVFQQKL PEWTPNVQYY SSKEYSRLNH  240
ALHYNVRGTL ALPVFEPPGQ SCVAVLELIM TSQKINYAPE VDKVCKALEV RFLFNYVILL  300
MFVSLQAVNL RSSEILEYPY SQICNEDRQN ALSEILEILT VVCETHNLPL AQTWVPCRHR  360
SVLAHGGGLK KSCSSFDGYC MGQVCMSITE VAFYVIDSHT WGFHDACVEH HLQQGQGVAG  420
RAFLSQNMCF CENISQFCKT DYPLVHYALM FDLTSCFSIC LQSFHTGNDE YVLEXXXXXX  480
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  540
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXKT DYPLVHYALM FDLTSCFSIC  600
LQSFHTGNDE YVLEFFLPPS ISEFSEHKAL LGSILATMKQ NFQSLKVASG FELGEDGSIE  660
IVEILNGRVH SRLESVPIIQ SEKLSTRHDD ASPNMDEGVL PLDPLQQKII TSFDDINDRG  720
ILDDNSGGSI ARISSLETKT KKKTSQRKRG KTEKLISLDV LQNYFSGSLK DAAKSLGVCP  780
TTMKRICRQH GISRWPSRKI KKVNRSLSKL KCVIESVHGV EGAFGLNSPT TSPLHIASNK  840
LEHQTSLSIM PSEPKMKEND FDASKSQPQE PFIGMLVEGA DSCSKDLKNM CPLADAVLED  900
HILEASRTNP PCFDYAPLAQ KEIKIVTIKA TYRDDIIRFR VSLNCGIVEL REEISKRLKL  960
EVGTFDIKYL DDDQEWILVA CDADLQECID ILTSSDSNTI RLVVHDIVSI LGSSVESSE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013443315.10.0plant regulator RWP-RK family protein
SwissprotQ8RWY40.0NLP6_ARATH; Protein NLP6
TrEMBLA0A072TUX00.0A0A072TUX0_MEDTR; Plant regulator RWP-RK family protein
STRINGGLYMA09G25230.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein